Free 2013 Audi Q5 VIN Decoder

Discover the sophisticated allure of your Audi Q5. Use our free decoder below to unlock insights from ownership history to performance features. Enter your VIN now and make informed decisions with confidence.

Over 1 Million reports ran on
Bumper.com

Approved NMVTIS Data Provider

Approved NMVTIS Data Provider

Reference to these media organizations does not constitute or imply endorsement of Bumper or its products and services.

How to decode a 2013 Audi Q5 VIN

Characters 1-3 of a 2013 Audi Q5 VIN

World Manufacturer Identifier (WMI) codes are a unique three-letter or digit sequence that identifies the manufacturer of a vehicle, as well as its type and manufacturing location. For example, Audi Q5 models produced between 2009 and 2024 have a WMI beginning with “WA1,” indicating that they are manufactured by Audi AG in Ingolstadt, Germany. Specifically, this identifies these vehicles as multipurpose passenger vehicles, an indication of their design and intended use. Such WMIs are fundamental parts of the Vehicle Identification Number (VIN), which serves as a fingerprint for individual vehicles, providing specific information about each one, from its manufacturing specifics to unique features. In essence, the WMI is crucial for accurately identifying and tracking vehicles throughout their lifecycle.

List of WMI Codes for a 2013 Audi Q5

WMI: WA1

  • Model Years Covered: 2009-2024
  • Example VIN: WA1LFCFP2DA099514
  • Manufacturer Name: Audi AG
  • Vehicle Type: Multipurpose Passenger Vehicle (MPV)
  • City: Ingolstadt
  • State or Province:
  • Country: Germany

Characters 4-8 are the Vehicle Descriptor Section (VDS) of a 2013 Audi Q5 VIN

These characters correspond to components like:

  • Engine type
  • Transmission
  • Model or trim
  • Body style
  • Gross vehicle weight range

Below find the known vehicle descriptor codes for a 2013 Audi Q5:

Known VDS for a 2013 Audi Q5
LFCFPDGBFPVFCFPCFAFPWGAFPCFCFPLFAFPMFCFPLGCFPCFBFP
WGBFPDGAFPCGCFPMGCFPLFBFPC8AFPC8BFPC8CFP

Auto manufacturers have some discretion to decide how they want to code this section, but its contents and decoded results are generally consistent.

Character 9 is the “check digit” in a 2013 Audi Q5 VIN.

Based on a formula developed by the US Department of Transportation, it helps reduce fraud by ensuring the validity of the VIN.

10th Character in the 2013 Audi Q5 VIN — Year Code

Year Code Year
D 2013

11th Character in the 2013 Audi Q5 VIN — Plant Code(s)

Known 2013 Audi Q5 Assembly Factory VIN Code(s)

Plant Code Plant City Plant State Plant Country Plant Company Name Example VIN
1 Gyor Hungary WA1LFAFP9D1061671
A Ingolstadt Germany WA1LFCFP2DA099514

VIN Characters 12 - 17 of a 2013 Audi Q5

The final 6 characters in a 2013 Audi Q5’s 17-digit VIN are its serial number, which will be unique to every vehicle.

Want to unlock even more detailed info about your vehicle?

How to find a 2013 Audi Q5’s VIN?

Locating the VIN number on your 2013 Audi Q5 is key for identification. Here’s how to find it:

  1. Look at the dashboard on the driver’s side of your Audi Q5, typically near the place where the dashboard meets the windshield.
  2. Inspect the driver’s side door jamb. Your 2013 Audi Q5 should have a sticker with the VIN where the door latches when closed.
  3. Check under the hood. You might find the VIN on a plaque or a sticker affixed to parts of the engine bay.
  4. Examine your vehicle’s registration documents or insurance card. The VIN for your Audi Q5 will be printed there.
  5. Look into the spare tire wheel well. Sometimes, the VIN can be found in this location on certain vehicles.
  6. Review the user manual or service book that came with your Audi Q5. It might contain a record of the VIN.
VIN Decoder

What info can a 2013 Audi Q5 VIN reveal?

  • Model Year: The VIN can reveal the vehicles model year being the year 2013, providing insights into the age and potential market value of the vehicle.
  • Engine Type and Fuel Efficiency: The vehicle comes with a 1984 CC engine with an output power of 211 hp. Moreover, its flexible fuel system allows the use of both gasoline and Ethanol (E85), indicating a model designed for performance and possibly better fuel efficiency.
  • Safety Features: The vehicle is equipped with curtain airbags in the 1st and 2nd rows, front airbags for the driver and passenger, as well as side airbags for the 1st row, prioritizing occupant safety.
  • Body Class and Doors: The VIN suggests the vehicle is classified as a Sport Utility Vehicle (SUV)/Multi-Purpose Vehicle (MPV) with four doors, indicating it is designed for versatility and practicality, suitable for both city driving and off-road adventures.
  • Fuel Type: The vehicle supports gasoline as its primary fuel type and Ethanol (E85) as a secondary option, offering fuel flexibility, which might be advantageous for reducing fuel costs or minimizing environmental impact.
  • Manufacturing Location: The vehicle was assembled in Ingolstadt, Germany, potentially hinting at high build quality and engineering standards.
  • Vehicle Series and Features: As part of the 2.0T Premium Plus series, this model likely includes a range of high-end features and finishes, suggesting a focus on luxury and driver comfort.
VIN Decoder

Don’t have your 2013 Audi Q5’s VIN handy? Try our license plate lookup instead!

Sample VIN Decode Report for a 2013 Audi Q5

Vehicle Spec Value
Body Class Sport Utility Vehicle (SUV)/Multi-Purpose Vehicle (MPV)
Curtain Air Bag Locations 1st and 2nd Rows
Displacement (CC) 1984
Displacement (CI) 121.071108283
Displacement (L) 1.984000
Doors 4
Engine Brake (hp) From 211.00
Engine Manufacturer Audi
Engine Model Flexible Fuel - E85
Engine Number of Cylinders 4
Front Air Bag Locations 1st Row (Driver and Passenger)
Fuel Type - Primary Gasoline
Fuel Type - Secondary Ethanol (E85)
Gross Vehicle Weight Rating From Class 1D: 5,001 - 6,000 lb (2,268 - 2,722 kg)
Model Q5
Model Year 2013
Other Engine Info 50-St/Can. BIN 5 / ULEV II emission std. Emissions Certification Test Group: DADXT02.04UB/DADXJ02.0FUB E85
Plant City Ingolstadt
Plant Company Name
Plant Country Germany
Seat Belt Type Manual
Series 2.0T Premium Plus
Side Air Bag Locations 1st Row (Driver and Passenger)
Tire Pressure Monitoring System (TPMS) Type Indirect
Vehicle Descriptor WA1LFCFP*DA
Vehicle Type Multipurpose Passenger Vehicle
Sample_VIN WA1LFCFP2DA099514

Decode other Q5 Years

Home > VIN Decoder > Audi > Q5 > 2013

Ready, Set, Bumper...

Try Bumper today and learn more about a vehicle you plan to buy or already own.

TRY Bumper Today
Race flag