Free 2018 Chevrolet Traverse VIN Decoder

Unlock the 2018 Chevrolet Traverse's luxurious comfort and versatility for your family journeys. Explore how this dependable SUV is your perfect travel partner, highlighting features that elevate every drive. Use our free decoder by entering your VIN below for an insightful overview.

Over 1 Million reports ran on
Bumper.com

Approved NMVTIS Data Provider

Approved NMVTIS Data Provider

Reference to these media organizations does not constitute or imply endorsement of Bumper or its products and services.

How to decode a 2018 Chevrolet Traverse VIN

Characters 1-3 of a 2018 Chevrolet Traverse VIN

A World Manufacturer Identifier (WMI) is the initial sequence of three characters found in the Vehicle Identification Number (VIN), uniquely identifying the manufacturer of the vehicle worldwide. For instance, in the case of a 2018 Chevrolet Traverse, the WMI “1GN” indicates that the vehicle was manufactured by General Motors LLC in the United States, specifically in Warren, Michigan. This sequence not only clues us into the manufacturing entity but also the vehicle type, which, for the Chevrolet Traverse, is classified as a Multipurpose Passenger Vehicle (MPV). Such identifiers are crucial for recognizing vehicle specifications, history, and compliance standards across the globe. They serve as a blueprint, revealing significant manufacturing details essential for both industry professionals and consumers.

List of WMI Codes for a 2018 Chevrolet Traverse

WMI: 1GN

  • Model Years Covered: 2009-2023
  • Example VIN: 1GNEVLKW0JJ130177
  • Manufacturer Name: General Motors LLC
  • Vehicle Type: Multipurpose Passenger Vehicle (MPV)
  • City: Warren
  • State or Province: Michigan
  • Country: United States

Characters 4-8 are the Vehicle Descriptor Section (VDS) of a 2018 Chevrolet Traverse VIN

These characters correspond to components like:

  • Engine type
  • Transmission
  • Model or trim
  • Body style
  • Gross vehicle weight range

Below find the known vehicle descriptor codes for a 2018 Chevrolet Traverse:

Known VDS for a 2018 Chevrolet Traverse
EVLKWEVMKWERKKWERFKWEVKKWEREKWEVGKWERGKWEVJKWERJKX
ERHKWERLKWEVHKWERMKWEVFKW

Auto manufacturers have some discretion to decide how they want to code this section, but its contents and decoded results are generally consistent.

Character 9 is the “check digit” in a 2018 Chevrolet Traverse VIN.

Based on a formula developed by the US Department of Transportation, it helps reduce fraud by ensuring the validity of the VIN.

10th Character in the 2018 Chevrolet Traverse VIN — Year Code

Year Code Year
J 2018

11th Character in the 2018 Chevrolet Traverse VIN — Plant Code(s)

Known 2018 Chevrolet Traverse Assembly Factory VIN Code(s)

Plant Code Plant City Plant State Plant Country Plant Company Name Example VIN
J Lansing - Delta Township Michigan United States Gmna 1GNEVLKW0JJ130177

VIN Characters 12 - 17 of a 2018 Chevrolet Traverse

The final 6 characters in a 2018 Chevrolet Traverse’s 17-digit VIN are its serial number, which will be unique to every vehicle.

Check your Chevrolet Traverse’s VIN below:

How to find a 2018 Chevrolet Traverse’s VIN?

Locating the VIN number on your 2018 Chevrolet Traverse is key for identification. Here’s how to find it:

  1. Look at the dashboard on the driver’s side of your Chevrolet Traverse, and you should find the VIN visible through the windshield.
  2. The door jamb on the driver’s side is another common location; check for a sticker or plate on your 2018 Chevrolet Traverse when you open the door.
  3. Peek under the hood of your Traverse to find the VIN on a label or embossed on the engine block.
  4. Check your Chevrolet Traverse’s vehicle registration documents, insurance papers, or the title (sometimes called the pink slip) for the VIN.
VIN Decoder

What info can a 2018 Chevrolet Traverse VIN reveal?

  • Model Year: The VIN can reveal the vehicle’s model year, indicating it as the year 2018, offering insights into the age and potential market value of the vehicle.
  • Body Class and Doors: The VIN can specify the body class, categorizing the vehicle as a Sport Utility Vehicle (SUV)/Multi-Purpose Vehicle (MPV), potentially reflecting its design and utility.
  • Engine Type: The Chevrolet Traverse features a 3.6-liter V-shaped engine with Spark Ignited Direct Injection, manufactured by GM, hinting at its power and performance characteristics.
  • Safety Features: Standard safety options include Anti-lock Braking System (ABS), Backup Camera, and Blind Spot Warning (BSW), while options like Low Speed Forward Automatic Braking and Lane Keeping Assistance (LKA) can possibly enhance the vehicle’s safety profile.
  • Fuel Efficiency and Drive Type: It runs on gasoline with Front-Wheel Drive (FWD) capability, laying out the basics of its fuel usage and drivetrain.
  • Advanced Technology: Optional advanced features such as Adaptive Driving Beam (ADB) and Automatic Crash Notification (ACN) showcase potential advancements in driving assistance and post-collision safety.
  • Airbag Locations and Restraint Systems: Airbags are located in all rows and the front 1st row for driver and passenger, alongside a manual seat belt type, emphasizing potential passenger safety throughout the vehicle.
VIN Decoder

Don’t have your 2018 Chevrolet Traverse’s VIN handy? Try our license plate lookup instead!

Sample VIN Decode Report for a 2018 Chevrolet Traverse

Vehicle Spec Value
Active Safety System Note Rear Cross Traffic Alert: Standard; Rear Park Assist: Standard; Low Speed Forward Automatic Braking: Optional; Following Distance Indicator: Optional
Adaptive Driving Beam (ADB) Optional
Anti-lock Braking System (ABS) Standard
Auto-Reverse System for Windows and Sunroofs Standard
Automatic Crash Notification (ACN) / Advanced Automatic Crash Notification (AACN) Standard
Axles 2
Backup Camera Standard
Base Price ($) 45000
Blind Spot Warning (BSW) Standard
Body Class Sport Utility Vehicle (SUV)/Multi-Purpose Vehicle (MPV)
Brake System Type Hydraulic
Crash Imminent Braking (CIB) Optional
Curtain Air Bag Locations All Rows
Daytime Running Light (DRL) Standard
Displacement (CC) 3600.0
Displacement (CI) 219.68547874103
Displacement (L) 3.6
Doors 4
Drive Type AWD/All-Wheel Drive
Dynamic Brake Support (DBS) Standard
Electronic Stability Control (ESC) Standard
Engine Configuration V-Shaped
Engine Manufacturer GM
Engine Model LFY - Spark Ignited Direct injection, ATSS, GEN 1
Engine Number of Cylinders 6
Forward Collision Warning (FCW) Optional
Front Air Bag Locations 1st Row (Driver and Passenger)
Fuel Type - Primary Gasoline
Gross Vehicle Weight Rating From Class 2E: 6,001 - 7,000 lb (2,722 - 3,175 kg)
Keyless Ignition Standard
Lane Departure Warning (LDW) Optional
Lane Keeping Assistance (LKA) Optional
Model Traverse
Model Year 2018
Number of Seat Rows 2
Number of Seats 5
Number of Wheels 4
Other Restraint System Info Front Inboard Seat Side Airbag in First Row.
Plant City Lansing - Delta Township
Plant Company Name GMNA
Plant Country United States
Plant State Michigan
Seat Belt Type Manual
Semiautomatic Headlamp Beam Switching Standard
Series Premier
Side Air Bag Locations 1st Row (Driver and Passenger)
Steering Location Left-Hand Drive (LHD)
Tire Pressure Monitoring System (TPMS) Type Direct
Top Speed (MPH) 130
Traction Control Standard
Transmission Speeds 9
Transmission Style Automatic
Valve Train Design Dual Overhead Cam (DOHC)
Vehicle Descriptor 1GNEVJKW*JJ
Vehicle Type Multipurpose Passenger Vehicle
Wheel Base (inches) From 120.9
Wheel Size Front (inches) 20
Wheel Size Rear (inches) 20
Sample_VIN 1GNEVJKW0JJ100472

Source

Decode other Traverse Years

Ready, Set, Bumper...

Try Bumper today and learn more about a vehicle you plan to buy or already own.

TRY Bumper Today
Race flag